Structure of PDB 8fl4 Chain NP

Receptor sequence
>8fl4NP (length=104) Species: 9606 (Homo sapiens) [Search protein sequence]
RSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRFDPDLPGGGLHRCLAC
ARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRR
LAVP
3D structure
PDB8fl4 Principles of human pre-60 S biogenesis.
ChainNP
Resolution2.89 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna NP R3 S4 R5 R6 T7 H10 R11 A12 H13 S14 L15 R17 K20 A21 R23 R68 N75 R81 K83 D84 K86 K87 R88 K90 R1 S2 R3 R4 T5 H8 R9 A10 H11 S12 L13 R15 K18 A19 R21 R52 N59 R65 K67 D68 K70 K71 R72 K74
BS02 ZN NP C66 H79 H85 C50 H63 H69
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
GO:1990275 preribosome binding
Biological Process
GO:0042254 ribosome biogenesis
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:1903026 negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8fl4, PDBe:8fl4, PDBj:8fl4
PDBsum8fl4
PubMed37410842
UniProtO00488|ZN593_HUMAN Zinc finger protein 593 (Gene Name=ZNF593)

[Back to BioLiP]