Structure of PDB 7mq8 Chain NN

Receptor sequence

>7mq8NN (length=42) Species: 9606 (Homo sapiens) [Search protein sequence]

ASKGRKLRFHVLSKLLSFMAPIDHTTMNDDARTELYRSLFGQ

3D structure

PDB

7mq8 Nucleolar maturation of the human small subunit processome.

Chain

Resolution

3.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	NN	S510 K511 R516	S2 K3 R8

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0019901	protein kinase binding
GO:0043522	leucine zipper domain binding
GO:0048156	tau protein binding

	Biological Process
GO:0006357	regulation of transcription by RNA polymerase II
GO:0007155	cell adhesion
GO:0007346	regulation of mitotic cell cycle
GO:0040016	embryonic cleavage
GO:0042254	ribosome biogenesis
GO:0042274	ribosomal small subunit biogenesis
GO:0042985	negative regulation of amyloid precursor protein biosynthetic process
GO:0043066	negative regulation of apoptotic process
GO:0045893	positive regulation of DNA-templated transcription
GO:2001234	negative regulation of apoptotic signaling pathway

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005667	transcription regulator complex
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0032040	small-subunit processome

External links

PDB	RCSB:7mq8, PDBe:7mq8, PDBj:7mq8
PDBsum	7mq8
PubMed	34516797
UniProt	Q9NY61\|AATF_HUMAN Protein AATF (Gene Name=AATF)