Structure of PDB 8fkv Chain NM

Receptor sequence

>8fkvNM (length=182) Species: 9606 (Homo sapiens) [Search protein sequence]

MQSDDVIWDTLGNKQFCSFKIRTKTQSFCRNEYSLTGLCNRSSCPLANSQ
YATIKEEKGQCYLYMKVIERAAFPRRLWERVRLSKNYEKALEQIDENLIY
WPRFIRHKCKQRFTKITQYLIRIRKLTLKRQRKLVPLSKKVERREKRREE
KALIAAQLDNAIEKELLERLKQDTYGDIYNFP

3D structure

PDB

8fkv Principles of human pre-60 S biogenesis.

Chain

Resolution

2.47 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	NM	W8 N13 K14 F16 S18 R22 Q26 S27 R30 C39 N40 R41 S42 R103 H107 R124 K125 P136 K139 K140 R143 K146 R147	W8 N13 K14 F16 S18 R22 Q26 S27 R30 C39 N40 R41 S42 R103 H107 R124 K125 P136 K139 K140 R143 K146 R147
BS02	SF4	NM	C17 F19 K20 C29 C39 C44 L46	C17 F19 K20 C29 C39 C44 L46

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding

	Biological Process
GO:0000460	maturation of 5.8S rRNA
GO:0000470	maturation of LSU-rRNA

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0030687	preribosome, large subunit precursor
GO:0043231	intracellular membrane-bounded organelle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8fkv, PDBe:8fkv, PDBj:8fkv
PDBsum	8fkv
PubMed	37410842
UniProt	Q9BXY0\|MAK16_HUMAN Protein MAK16 homolog (Gene Name=MAK16)

[Back to BioLiP]