Structure of PDB 8fkr Chain NM

Receptor sequence
>8fkrNM (length=182) Species: 9606 (Homo sapiens) [Search protein sequence]
MQSDDVIWDTLGNKQFCSFKIRTKTQSFCRNEYSLTGLCNRSSCPLANSQ
YATIKEEKGQCYLYMKVIERAAFPRRLWERVRLSKNYEKALEQIDENLIY
WPRFIRHKCKQRFTKITQYLIRIRKLTLKRQRKLVPLSKKVERREKRREE
KALIAAQLDNAIEKELLERLKQDTYGDIYNFP
3D structure
PDB8fkr Principles of human pre-60 S biogenesis.
ChainNM
Resolution2.89 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna NM W8 N13 K14 F16 S18 R22 S27 R30 C39 N40 S42 R103 H107 R124 P136 S138 K139 K140 R143 R144 R147 W8 N13 K14 F16 S18 R22 S27 R30 C39 N40 S42 R103 H107 R124 P136 S138 K139 K140 R143 R144 R147
BS02 SF4 NM L11 C17 F19 K20 C29 C39 C44 L46 L11 C17 F19 K20 C29 C39 C44 L46
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000460 maturation of 5.8S rRNA
GO:0000470 maturation of LSU-rRNA
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fkr, PDBe:8fkr, PDBj:8fkr
PDBsum8fkr
PubMed37410842
UniProtQ9BXY0|MAK16_HUMAN Protein MAK16 homolog (Gene Name=MAK16)

[Back to BioLiP]