Structure of PDB 8fkt Chain NK

Receptor sequence

>8fktNK (length=67) Species: 9606 (Homo sapiens)

AKSLRSKWKRKMRAEKRKKNAPKEASRLKSILKLKRNKKTLLDQHGQYPI
WMNQRQRKRLKAKREKR

3D structure

• PDB: 8fkt Principles of human pre-60 S biogenesis.
• Chain: NK
• Resolution: 2.81 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	NK	A2 K3 S4 L5 R6 S7 K8 R11 K12 M13 R14 K17 R18 N82 K83 K84 H90 G91 Q92 N98 Q99 R100 R104 K106 R109	A1 K2 S3 L4 R5 S6 K7 R10 K11 M12 R13 K16 R17 N37 K38 K39 H45 G46 Q47 N53 Q54 R55 R59 K61 R64

Gene Ontology

Molecular Function

• GO:0001099 basal RNA polymerase II transcription machinery binding
• GO:0003723 RNA binding
• GO:0005515 protein binding

Biological Process

• GO:0060999 positive regulation of dendritic spine development
• GO:0097484 dendrite extension

Cellular Component

• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0005730 nucleolus

External links

• PDB: RCSB:8fkt, PDBe:8fkt, PDBj:8fkt
• PDBsum: 8fkt
• PubMed: 37410842
• UniProt: Q9BRT6|LLPH_HUMAN Protein LLP homolog (Gene Name=LLPH)