Structure of PDB 8gxs Chain NG

Receptor sequence
>8gxsNG (length=107) Species: 9606 (Homo sapiens) [Search protein sequence]
AVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEV
LELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHK
SLIGKKG
3D structure
PDB8gxs Structures of +1 nucleosome-bound PIC-Mediator complex.
ChainNG
Resolution4.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna NG R1045 V1046 A1048 K1079 R1080 R30 V31 A33 K64 R65
BS02 dna NG S1018 R1019 G1030 R1031 S3 R4 G15 R16
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Nov 17 20:27:14 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8gxs', asym_id = 'NG', title = 'Structures of +1 nucleosome-bound PIC-Mediator complex.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8gxs', asym_id='NG', title='Structures of +1 nucleosome-bound PIC-Mediator complex.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0000786,0003677,0030527,0046982', uniprot = '', pdbid = '8gxs', asym_id = 'NG'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000786,0003677,0030527,0046982', uniprot='', pdbid='8gxs', asym_id='NG')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>