Structure of PDB 8fkq Chain NG |
>8fkqNG (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] |
QERLEKIKQRDKRLEWEMMCRVKPDVVQDKETERNLQRIATRGVVQLFNA VQKHQKNVDEKVKEAGSSMRKRAKLISTVSKKDFISVLR |
|
PDB | 8fkq Principles of human pre-60 S biogenesis. |
Chain | NG |
Resolution | 2.76 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
NG |
Q135 R139 |
Q9 R13 |
|
|
|
|