Structure of PDB 7mq9 Chain NG

Receptor sequence

>7mq9NG (length=116) Species: 9606 (Homo sapiens) [Search protein sequence]

ENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESSPYAA
MLAAQDVAQRCKELGITALHIKLRATGGNRTKTPGPGAQSALRALARSGM
KIGRIEDVTPIPSDST

3D structure

PDB

7mq9 Nucleolar maturation of the human small subunit processome.

Chain

Resolution

3.87 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	NG	N38 D39 F41 H43 G49 T52 R55 T57 M60 D65 R66 R121 S137 D138	N14 D15 F17 H19 G25 T28 R31 T33 M36 D41 R42 R97 S113 D114

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0045182	translation regulator activity
GO:0048027	mRNA 5'-UTR binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006417	regulation of translation
GO:0030218	erythrocyte differentiation
GO:0030490	maturation of SSU-rRNA
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005925	focal adhesion
GO:0014069	postsynaptic density
GO:0015935	small ribosomal subunit
GO:0016020	membrane
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0032040	small-subunit processome
GO:0045202	synapse
GO:0070062	extracellular exosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7mq9, PDBe:7mq9, PDBj:7mq9
PDBsum	7mq9
PubMed	34516797
UniProt	P62263\|RS14_HUMAN Small ribosomal subunit protein uS11 (Gene Name=RPS14)