Structure of PDB 8fl3 Chain NF

Receptor sequence

>8fl3NF (length=233) Species: 9606 (Homo sapiens)

PQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYH
KQRHAEKIQMKKTIKMHEKRNTKTPQGAVPAYLLDRAGKWEVPLPKVRAQ
GETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLR
FKKAHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSEL
GLVTQGGKVIWGKYAQVTNNPENDGCINAVLLV

3D structure

• PDB: 8fl3 Principles of human pre-60 S biogenesis.
• Chain: NF
• Resolution: 2.53 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	NF	P2 Q3 E5 Y6 I7 E8 K12 R25 K26 S29 R30 A32 H33 S36 A39 K40 K41 M42 I43 G44 L45 K48 L49 H51 K52 R54 H55 K58 K63 K66 K123 K134 I136 T138 G139 R141 K144 W146 R162 K163 P165 K166 Y167 R169 F170 I171 P173 M174 G175 H182 K189 T191 L207 T210 Q232 G233 N246 D251 N255	P1 Q2 E4 Y5 I6 E7 K11 R24 K25 S28 R29 A31 H32 S35 A38 K39 K40 M41 I42 G43 L44 K47 L48 H50 K51 R53 H54 K57 K62 K65 K96 K107 I109 T111 G112 R114 K117 W119 R135 K136 P138 K139 Y140 R142 F143 I144 P146 M147 G148 H155 K162 T164 L180 T183 Q205 G206 N219 D224 N228

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0000460 maturation of 5.8S rRNA
• GO:0000470 maturation of LSU-rRNA
• GO:0006364 rRNA processing
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fl3, PDBe:8fl3, PDBj:8fl3
• PDBsum: 8fl3
• PubMed: 37410842
• UniProt: O95478|NSA2_HUMAN Ribosome biogenesis protein NSA2 homolog (Gene Name=NSA2)