Structure of PDB 7mq8 Chain NE

Receptor sequence

>7mq8NE (length=100) Species: 9606 (Homo sapiens)

FNLEKARLEVHRFGITGYGKGKERILEQERAIMLGAKPPKKSYVNYKVLQ
EQIKEKKAAKEEEKRLAQETDKKSAPSILSGKFKNGTLILSPVDIKKINS

3D structure

• PDB: 7mq8 Nucleolar maturation of the human small subunit processome.
• Chain: NE
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	NE	K206 Y208 Y211 L214 I218 K254 S258 K270 K272	K41 Y43 Y46 L49 I53 K73 S77 K82 K84
BS02	rna	NE	Y208 Y211 K212 Q215	Y43 Y46 K47 Q50

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0005730 nucleolus
• GO:0032040 small-subunit processome

External links

• PDB: RCSB:7mq8, PDBe:7mq8, PDBj:7mq8
• PDBsum: 7mq8
• PubMed: 34516797
• UniProt: Q8NDD1|CA131_HUMAN Uncharacterized protein C1orf131 (Gene Name=C1orf131)