Structure of PDB 8gxq Chain NC

Receptor sequence
>8gxqNC (length=103) Species: 9606 (Homo sapiens) [Search protein sequence]
AVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEV
LELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHK
SLI
3D structure
PDB8gxq Structures of +1 nucleosome-bound PIC-Mediator complex.
ChainNC
Resolution5.04 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna NC A816 V817 S818 R819 A1 V2 S3 R4
BS02 dna NC R845 V846 G847 A848 K879 R880 R30 V31 G32 A33 K64 R65
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Wed Apr 30 12:46:45 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8gxq', asym_id = 'NC', title = 'Structures of +1 nucleosome-bound PIC-Mediator complex.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8gxq', asym_id='NC', title='Structures of +1 nucleosome-bound PIC-Mediator complex.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0000786,0003677,0030527,0046982', uniprot = '', pdbid = '8gxq', asym_id = 'NC'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000786,0003677,0030527,0046982', uniprot='', pdbid='8gxq', asym_id='NC')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>