Structure of PDB 8fl0 Chain NB

Receptor sequence
>8fl0NB (length=67) Species: 9606 (Homo sapiens) [Search protein sequence]
MKRPKLKKASKRMTCHKRYKIQKKVREHHRKLRKEADPGVPNSAPFKEAL
LREAELRKQRLEELKQQ
3D structure
PDB8fl0 Principles of human pre-60 S biogenesis.
ChainNB
Resolution2.91 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna NB M1 K2 R3 P4 K7 S10 K11 R12 C15 Y19 K20 I21 V25 R26 H28 P51 N52 M1 K2 R3 P4 K7 S10 K11 R12 C15 Y19 K20 I21 V25 R26 H28 P41 N42
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0048027 mRNA 5'-UTR binding
Biological Process
GO:0017145 stem cell division
GO:0019827 stem cell population maintenance
GO:0032206 positive regulation of telomere maintenance
GO:0033235 positive regulation of protein sumoylation
GO:0042127 regulation of cell population proliferation
GO:1902895 positive regulation of miRNA transcription
GO:1904816 positive regulation of protein localization to chromosome, telomeric region
Cellular Component
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0016020 membrane
GO:0016604 nuclear body
GO:0030496 midbody

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fl0, PDBe:8fl0, PDBj:8fl0
PDBsum8fl0
PubMed37410842
UniProtQ9BVP2|GNL3_HUMAN Guanine nucleotide-binding protein-like 3 (Gene Name=GNL3)

[Back to BioLiP]