Structure of PDB 8ipa Chain NA

Receptor sequence

>8ipaNA (length=116) Species: 4565 (Triticum aestivum) [Search protein sequence]

RTSVTFHRPKTLSKARDPKYPRISTPGRNKLDQYQILKYPLTTESAMKKI
EDNNTLVFIVDLKADKKKIKAAVKKMYDIQAKKVNTLIRPDGKKKAYVKL
TPDYDALDVANKIGII

3D structure

PDB

8ipa Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	NA	V40 T41 F42 H43 R44 S49 K50 R52 D53 P54 K55 Y56 R58 T79 S81 K85 N89 D101 K102 N121 T122 L123 P126 K130 Y133 K135	V4 T5 F6 H7 R8 S13 K14 R16 D17 P18 K19 Y20 R22 T43 S45 K49 N53 D65 K66 N85 T86 L87 P90 K94 Y97 K99
BS02	rna	NA	F42 P45 T47 L48 R52 R64 K66 Q71 K99 K103	F6 P9 T11 L12 R16 R28 K30 Q35 K63 K67

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links