Structure of PDB 5wlc Chain NA

Receptor sequence

>5wlcNA (length=207) Species: 1247190 (Saccharomyces cerevisiae BY4741)

KNLSSFEKQQIEIRKQIEQLENEAVAEKKWSLKGEVKAKDRPEDALLTEE
LEFDRTAKPVPVITSEVTESLEDMIRRRIQDSNFDDLQRRTLALSEELQK
AHSEISELYANLVYKLDVLSSVHFVPKPASTSLEIRVETPTISMEDAQPL
YMSNASSLAPQEIYNVGKAEKDGEIRLKNGVAMSKEELTREDKNRLRRAL
KRKRSKA

3D structure

• PDB: 5wlc The complete structure of the small-subunit processome.
• Chain: NA
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	NA	K322 A491 L509 K510 N511 R522 K525 R527 R529 R530 R534 S537 K538	K28 A159 L177 K178 N179 R190 K193 R195 R197 R198 R202 S205 K206

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0005515 protein binding
• GO:0042802 identical protein binding

Biological Process

• GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0030490 maturation of SSU-rRNA
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
• GO:0030686 90S preribosome
• GO:0032040 small-subunit processome
• GO:0034457 Mpp10 complex
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5wlc, PDBe:5wlc, PDBj:5wlc
• PDBsum: 5wlc
• PubMed: 28945246
• UniProt: P47083|MPP10_YEAST U3 small nucleolar RNA-associated protein MPP10 (Gene Name=MPP10)