Structure of PDB 5tga Chain N5

Receptor sequence

>5tgaN5 (length=121) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

KALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSET
AMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKK
AYVRLTADYDALDIANRIGYI

3D structure

PDB

5tga Molecular insights into protein synthesis with proline residues.

Chain

Resolution

3.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N5	T31 R33 L34 P35 K36 T37 K39 L40 R42 K45 Y46 T71 K75 N91 K92 Y93 N111 T112 L113 P116 K120 Y123 R125	T10 R12 L13 P14 K15 T16 K18 L19 R21 K24 Y25 T50 K54 N70 K71 Y72 N90 T91 L92 P95 K99 Y102 R104
BS02	rna	N5	L24 R27 P35 T37 L38 R42 S48 K49 P52 H53 Y54 N55 R56 K61 K89 Y93 Q94	L3 R6 P14 T16 L17 R21 S27 K28 P31 H32 Y33 N34 R35 K40 K68 Y72 Q73

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

External links

PDB	RCSB:5tga, PDBe:5tga, PDBj:5tga
PDBsum	5tga
PubMed	27827794
UniProt	P04456\|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)