Structure of PDB 4u4o Chain N5

Receptor sequence

>4u4oN5 (length=121) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

KALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSET
AMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKK
AYVRLTADYDALDIANRIGYI

3D structure

PDB

4u4o ?

Chain

Resolution

3.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N5	T31 R33 L34 P35 K36 K39 L40 R42 P44 K45 Y46 S69 T71 K75 N91 K92 Y93 N111 T112 L113 V114 P116 K120 K121 Y123 R125	T10 R12 L13 P14 K15 K18 L19 R21 P23 K24 Y25 S48 T50 K54 N70 K71 Y72 N90 T91 L92 V93 P95 K99 K100 Y102 R104
BS02	rna	N5	K25 R27 P35 T37 L38 S48 K49 P52 H53 Y54 N55 R56 K61 K89 Y93 Q94	K4 R6 P14 T16 L17 S27 K28 P31 H32 Y33 N34 R35 K40 K68 Y72 Q73

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4u4o, PDBe:4u4o, PDBj:4u4o
PDBsum	4u4o
PubMed	25209664
UniProt	P04456\|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)