Structure of PDB 6gzz Chain N4

Receptor sequence
>6gzzN4 (length=60) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKG
QLPGVRKASW
3D structure
PDB6gzz Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
ChainN4
Resolution4.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N4 A2 R3 K4 A5 L6 E8 K9 K11 R12 F16 K17 V18 R19 A20 Y21 T22 R23 A30 R31 V33 Y34 R35 F36 R41 E46 S60 W61 A1 R2 K3 A4 L5 E7 K8 K10 R11 F15 K16 V17 R18 A19 Y20 T21 R22 A29 R30 V32 Y33 R34 F35 R40 E45 S59 W60
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gzz, PDBe:6gzz, PDBj:6gzz
PDBsum6gzz
PubMed30301898
UniProtP0DOY6|RS14Z_THET8 Small ribosomal subunit protein uS14 (Gene Name=rpsZ)

[Back to BioLiP]