Structure of PDB 4u50 Chain N3

Receptor sequence
>4u50N3 (length=136) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SGNGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPA
ASLGDMVMATVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGV
IANPKGEMKGSAITGPVGKECADLWPRVASNSGVVV
3D structure
PDB4u50 ?
ChainN3
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna N3 N28 P67 S112 N27 P66 S111
BS02 rna N3 K10 F11 R12 S14 G16 P18 A21 I22 Y35 I37 K40 G41 S42 S44 R45 L46 N47 R48 L49 M59 T61 K63 K71 K83 R86 R88 F92 N98 K9 F10 R11 S13 G15 P17 A20 I21 Y34 I36 K39 G40 S41 S43 R44 L45 N46 R47 L48 M58 T60 K62 K70 K82 R85 R87 F91 N97
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4u50, PDBe:4u50, PDBj:4u50
PDBsum4u50
PubMed25209664
UniProtP0CX41|RL23A_YEAST Large ribosomal subunit protein uL14A (Gene Name=RPL23A)

[Back to BioLiP]