Structure of PDB 7nwg Chain N2

Receptor sequence
>7nwgN2 (length=117) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
VNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVK
LVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKD
YGKESQAKDVIEEYFKC
3D structure
PDB7nwg Blasticidin S inhibits mammalian translation and enhances production of protein encoded by nonsense mRNA.
ChainN2
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N2 R33 R36 E37 E58 K102 V104 R20 R23 E24 E45 K89 V91
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0042274 ribosomal small subunit biogenesis
GO:0090263 positive regulation of canonical Wnt signaling pathway
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:0043231 intracellular membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nwg, PDBe:7nwg, PDBj:7nwg
PDBsum7nwg
PubMed34157102
UniProtG1SFR8|RS12_RABIT Small ribosomal subunit protein eS12 (Gene Name=RPS12)

[Back to BioLiP]