Structure of PDB 6hcq Chain N2 |
>6hcqN2 (length=117) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] |
VNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVK LVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKD YGKESQAKDVIEEYFKC |
|
PDB | 6hcq ZNF598 Is a Quality Control Sensor of Collided Ribosomes. |
Chain | N2 |
Resolution | 6.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
N2 |
R33 R36 V104 |
R20 R23 V91 |
|
|
|
|