Structure of PDB 6gzq Chain N1

Receptor sequence
>6gzqN1 (length=111) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSA
SSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKAL
AEGAREGGLEF
3D structure
PDB6gzq Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
ChainN1
Resolution3.28 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N1 R3 L4 R10 F12 N16 R17 R89 Y94 R2 L3 R9 F11 N15 R16 R88 Y93
BS02 rna N1 R10 R15 R25 R30 S31 L32 H34 Y36 S50 K62 T63 H95 G96 R97 R9 R14 R24 R29 S30 L31 H33 Y35 S49 K61 T62 H94 G95 R96
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gzq, PDBe:6gzq, PDBj:6gzq
PDBsum6gzq
PubMed30301898
UniProtQ5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]