Structure of PDB 5ndg Chain N0

Receptor sequence

>5ndgN0 (length=170) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

HFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHKVK
KASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRVAA
VETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKFPL
PHRVQKSTKTFSYKRPSTFY

3D structure

PDB

5ndg Aminoglycoside interactions and impacts on the eukaryotic ribosome.

Chain

Resolution

3.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N0	N62 N65 E66 H68 K71 S83 R84 H88 M90 Y91 K92 Q108 A111 A112 R113 H114 R115 R117 R137 Y139 L144 K146 H154 R155 K161 Y165 R167 P168 S169 T170 F171	N60 N63 E64 H66 K69 S81 R82 H86 M88 Y89 K90 Q106 A109 A110 R111 H112 R113 R115 R135 Y137 L142 K144 H152 R153 K159 Y163 R165 P166 S167 T168 F169
BS02	rna	N0	R13 S39 R40 Y43 Q46 H49 K50 V51 K52 R84 R117 R119	R11 S37 R38 Y41 Q44 H47 K48 V49 K50 R82 R115 R117

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5ndg, PDBe:5ndg, PDBj:5ndg
PDBsum	5ndg
PubMed	29208708
UniProt	P0CX23\|RL20A_YEAST Large ribosomal subunit protein eL20A (Gene Name=RPL20A)

[Back to BioLiP]