Structure of PDB 9fmd Chain N

Receptor sequence

>9fmdN (length=144) Species: 9606 (Homo sapiens)

MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIF
RIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENL
CCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG

3D structure

• PDB: 9fmd Mechanism for the initiation of spliceosome disassembly.
• Chain: N
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	A90 K93	A90 K93
BS02	rna	N	G39 R41 K42 Q95 G96 E98 T111 N112 T115 N116 C117 I118 R120 V121 P122 K125 L126 C134 T135 H136 S143	G39 R41 K42 Q95 G96 E98 T111 N112 T115 N116 C117 I118 R120 V121 P122 K125 L126 C134 T135 H136 S143
BS03	ZN	N	C105 C119 C134	C105 C119 C134
BS04	ZN	N	C101 C105 C137	C101 C105 C137
BS05	ZN	N	C101 C119	C101 C119

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0016922 nuclear receptor binding
• GO:0030374 nuclear receptor coactivator activity

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0045893 positive regulation of DNA-templated transcription
• GO:2000825 positive regulation of androgen receptor activity

Cellular Component

• GO:0000785 chromatin
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0071007 U2-type catalytic step 2 spliceosome

External links

• PDB: RCSB:9fmd, PDBe:9fmd, PDBj:9fmd
• PDBsum: 9fmd
• PubMed: 38925148
• UniProt: P41223|BUD31_HUMAN Protein BUD31 homolog (Gene Name=BUD31)