Structure of PDB 9fbv Chain N

Receptor sequence

>9fbvN (length=100) Species: 679895 (Escherichia coli BW25113)

AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTL
PRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW

3D structure

• PDB: 9fbv Paenilamicins from the honey bee pathogen Paenibacillus larvae are context-specific translocation inhibitors of protein synthesis.
• Chain: N
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	A2 K3 Q4 S5 M6 A8 R9 R13 K19 F21 R24 K28 L48 R53 S56 P57 S58 R59 R61 N62 R63 T67 R69 P70 H71 G72 R75 R81 I82 R85 K98 S100 W101	A1 K2 Q3 S4 M5 A7 R8 R12 K18 F20 R23 K27 L47 R52 S55 P56 S57 R58 R60 N61 R62 T66 R68 P69 H70 G71 R74 R80 I81 R84 K97 S99 W100

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:9fbv, PDBe:9fbv, PDBj:9fbv
• PDBsum: 9fbv
• PubMed: 38826346
• UniProt: P0AG59|RS14_ECOLI Small ribosomal subunit protein uS14 (Gene Name=rpsN)