Structure of PDB 9bct Chain N |
>9bctN (length=65) Species: 311400 (Thermococcus kodakarensis) [Search protein sequence] |
MIVPVRCFTCGKVLADKYYEFKKRVEAGEDPGKVLDDLGVERYCCRRTLL SHVELIDQVMVYKVY |
|
PDB | 9bct Structural basis of archaeal FttA-dependent transcription termination |
Chain | N |
Resolution | 2.5 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
N |
C7 C44 C45 |
C7 C44 C45 |
|
|
|
|