Structure of PDB 8wib Chain N

Receptor sequence
>8wibN (length=122) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGG
NVKRGDVVKAVVVRTVKERRRADGSYIKFDENAAVIIKNDNDPRGTRIFG
PVGRELREKKFMKIVSLAPEVL
3D structure
PDB8wib Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
ChainN
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N M1 Q3 E5 S6 I22 R23 L25 S28 S29 R31 Y32 K44 K67 E68 Y76 M1 Q3 E5 S6 I22 R23 L25 S28 S29 R31 Y32 K44 K67 E68 Y76
BS02 rna N P48 R97 P48 R97
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wib, PDBe:8wib, PDBj:8wib
PDBsum8wib
PubMed38245551
UniProtA0QSF9|RL14_MYCS2 Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]