Structure of PDB 8wi7 Chain N

Receptor sequence
>8wi7N (length=122) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGG
NVKRGDVVKAVVVRTVKERRRADGSYIKFDENAAVIIKNDNDPRGTRIFG
PVGRELREKKFMKIVSLAPEVL
3D structure
PDB8wi7 Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
ChainN
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N M1 Q3 Q4 E5 R7 I22 R23 L25 S28 S29 R31 Y32 T42 K44 K67 E68 R70 Y76 M1 Q3 Q4 E5 R7 I22 R23 L25 S28 S29 R31 Y32 T42 K44 K67 E68 R70 Y76
BS02 rna N P48 R97 P48 R97
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wi7, PDBe:8wi7, PDBj:8wi7
PDBsum8wi7
PubMed38245551
UniProtA0QSF9|RL14_MYCS2 Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]