Structure of PDB 8wgh Chain N |
>8wghN (length=84) Species: 141305 (Fittonia albivenis) [Search protein sequence] |
VIDYYLEKSKANKELNDKKRLATTDANFARAYTVEFGTCKFPENFTGCQD LAKQKKVPFLSEDLDIECEGKDIYKCGSNVFWKW |
|
PDB | 8wgh Cryo-EM structure of the red-shifted Fittonia albivenis PSI-LHCI |
Chain | N |
Resolution | 2.4 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CLA |
N |
N129 F130 G132 |
N44 F45 G47 |
|
|
|