Structure of PDB 8uu9 Chain N

Receptor sequence

>8uu9N (length=146) Species: 1642 (Listeria innocua)

MKLHELKPSEGSRKERNRVGRGTGSGNGKTSGRGHKGQKARSGGGVRLGF
EGGQLPLFRRIPKRGFTNINRKEFAIVNLDVLNRFEDGTEVTPELLIETG
IIRNEKSGIKILSDGNIEKKLTVKANKFSAAAKEAIEAAGGKTEVI

3D structure

• PDB: 8uu9 Mechanistic insights into the alternative ribosome recycling by HflXr.
• Chain: N
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	H4 L6 S9 G11 S12 R13 K14 R16 N17 R18 G20 R21 G22 G24 G28 K29 T30 S31 G32 R33 G34 H35 K36 G37 Q38 K39 R41 S42 G43 R47 F50 G52 G53 Q54 L55 R59 R60 P62 K63 R64 G65 F66 N68 I69 N70 R71 I76 R103 K110 L112 S113 S129	H4 L6 S9 G11 S12 R13 K14 R16 N17 R18 G20 R21 G22 G24 G28 K29 T30 S31 G32 R33 G34 H35 K36 G37 Q38 K39 R41 S42 G43 R47 F50 G52 G53 Q54 L55 R59 R60 P62 K63 R64 G65 F66 N68 I69 N70 R71 I76 R103 K110 L112 S113 S129

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8uu9, PDBe:8uu9, PDBj:8uu9
• PDBsum: 8uu9
• PubMed: 38407413
• UniProt: A0A0U5A6S7