Structure of PDB 8urh Chain N

Receptor sequence
>8urhN (length=129) Species: 562 (Escherichia coli) [Search protein sequence]
SMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKV
EGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGI
AVVSTSKGVMTDRAARQAGLGGEIICYVA
3D structure
PDB8urh Escherichia coli transcription-translation coupled complex class A (TTC-A) containing RfaH bound to ops signal, mRNA with a 21 nt long spacer, and fMet-tRNAs in E-site and P-site of the ribosome
ChainN
Resolution5.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N S2 M3 Q4 P6 D9 T12 R13 R15 N16 K22 S30 K31 K56 R80 P81 G82 Y86 R88 K89 S105 T106 S107 K108 L121 G122 E124 S1 M2 Q3 P5 D8 T11 R12 R14 N15 K21 S29 K30 K55 R79 P80 G81 Y85 R87 K88 S104 T105 S106 K107 L120 G121 E123
External links