Structure of PDB 8smr Chain N

Receptor sequence

>8smrN (length=181) Species: 287 (Pseudomonas aeruginosa)

AGDAAAGQAKAAVCGACHGADGNSPAPNFPKLAGQGERYLLKQMHDIKDG
KRTVLEMTGLLTNLSDQDLADIAAYFASQKMSVGMADPNLVAQGEALFRG
GKIAEGMPACTGCHSPSGVGIATAGFPHLGGQHATYVAKQLTDFREGTRT
NDGDTKIMQSIAAKLSNKDIAAISSYIQGLH

3D structure

• PDB: 8smr Structure of the bc 1 - cbb 3 respiratory supercomplex from Pseudomonas aeruginosa.
• Chain: N
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	N	M105 A106 P108 V111 P136 Y196 G199 L200 H201	M85 A86 P88 V91 P116 Y176 G179 L180 H181
BS02	HEC	N	Y59 K62 Q63 C130 C133 H134 F146 P147 L149 Y156 L161 R169 N171 I177 M178 I181 I193	Y39 K42 Q43 C110 C113 H114 F126 P127 L129 Y136 L141 R149 N151 I157 M158 I161 I173
BS03	HEC	N	C34 C37 H38 F49 P50 L52 Y59 Q63 R72 V74 E76 M77 L80 L81 Y156 K159 Q160	C14 C17 H18 F29 P30 L32 Y39 Q43 R52 V54 E56 M57 L60 L61 Y136 K139 Q140

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:8smr, PDBe:8smr, PDBj:8smr
• PDBsum: 8smr
• PubMed: 37751552
• UniProt: P00106|CYC4_PSEAE Cytochrome c4 (Gene Name=cc4)