Structure of PDB 8s8j Chain N

Receptor sequence

>8s8jN (length=151) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]

MGRMHSKGKGMSSSAIPYSRNAPAWFKGSSDGVVEQIIKYARKGLTPSQI
GVLLRDAHGVTQAKVITGNKILRILKSNGLAPEIPEDLYFLIKKAVSVRK
HLERNRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALV
N

3D structure

PDB

8s8j Structural basis of AUC codon discrimination during translation initiation in yeast.

Chain

Resolution

4.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	M1 G2 R3 M4 K7 K9 G10 M11 S12 S13 S14 A15 I16 P17 R20 S48 G51 V52 R55 T61 Q62 K64 K70 L72 R73 D87 F90 L91 K94 S97 H101 R104 R106 K107 D108 D110 K112 F113 L117 S120 R121 R124 R127 Y128	M1 G2 R3 M4 K7 K9 G10 M11 S12 S13 S14 A15 I16 P17 R20 S48 G51 V52 R55 T61 Q62 K64 K70 L72 R73 D87 F90 L91 K94 S97 H101 R104 R106 K107 D108 D110 K112 F113 L117 S120 R121 R124 R127 Y128

External links

PDB	RCSB:8s8j, PDBe:8s8j, PDBj:8s8j
PDBsum	8s8j
PubMed	39193907
UniProt	Q6CJK0

[Back to BioLiP]