Structure of PDB 8s1p Chain N

Receptor sequence

>8s1pN (length=119) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]

SYRKLGRTSAQRKAMLRDLTTDLIINERIETTETRAKELRSVVEKMITLG
KRGDLHARRQAAAYIRNEVANEENNQDALQKLFSDIATRYEERQGGYTRI
MKLGPRRGDGAPMAIIELV

3D structure

PDB

8s1p A role for the S4-domain containing protein YlmH in ribosome-associated quality control in Bacillus subtilis.

Chain

Resolution

1.96 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	S2 Y3 R4 K5 G7 R8 S10 Q12 R13 K14 L17 R18 D19 L20 D23 N27 I30 E31 T32 T33 T35 R36 K38 E39 R41 S42 E45 K46 T49 R53 L56 H57 R59 R60 Q61 A64 N68 E69 R94 Q95 G96 G97 T99 R100 K103 R107 R108 G109 D110 A112	S1 Y2 R3 K4 G6 R7 S9 Q11 R12 K13 L16 R17 D18 L19 D22 N26 I29 E30 T31 T32 T34 R35 K37 E38 R40 S41 E44 K45 T48 R52 L55 H56 R58 R59 Q60 A63 N67 E68 R93 Q94 G95 G96 T98 R99 K102 R106 R107 G108 D109 A111
BS02	MG	N	D23 E69	D22 E68

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8s1p, PDBe:8s1p, PDBj:8s1p
PDBsum	8s1p
PubMed	38811035
UniProt	P20277\|RL17_BACSU Large ribosomal subunit protein bL17 (Gene Name=rplQ)