Structure of PDB 8qpp Chain N

Receptor sequence
>8qppN (length=60) Species: 1423 (Bacillus subtilis) [Search protein sequence]
AKKSMIAKQQRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFRELAYKG
QIPGVKKASW
3D structure
PDB8qpp An evolutionarily conserved strategy for ribosome binding and inhibition by beta-coronavirus non-structural protein 1
ChainN
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N A2 K3 K4 S5 K9 R12 K15 F16 K17 V18 Q19 Y21 R29 H31 S32 R35 R41 R45 K58 S60 W61 A1 K2 K3 S4 K8 R11 K14 F15 K16 V17 Q18 Y20 R28 H30 S31 R34 R40 R44 K57 S59 W60
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qpp, PDBe:8qpp, PDBj:8qpp
PDBsum8qpp
PubMed38177497
UniProtF5HRV2

[Back to BioLiP]