Structure of PDB 8qpk Chain N

Receptor sequence
>8qpkN (length=133) Species: 9606 (Homo sapiens) [Search protein sequence]
FLGMPAPLGYVPGLGRGATGFTTRSDIGPAKDDEEADAIYAALDKRMDER
RKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGG
ELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVD
3D structure
PDB8qpk Structural insights into the cross-exon to cross-intron spliceosome switch
ChainN
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna N R111 R116 R123 R46 R51 R58
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0043021 ribonucleoprotein complex binding
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000245 spliceosomal complex assembly
GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0006403 RNA localization
GO:0008380 RNA splicing
GO:0045944 positive regulation of transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0016020 membrane
GO:0016607 nuclear speck
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8qpk, PDBe:8qpk, PDBj:8qpk
PDBsum8qpk
PubMed38778104
UniProtO94906|PRP6_HUMAN Pre-mRNA-processing factor 6 (Gene Name=PRPF6)

[Back to BioLiP]