Structure of PDB 8pw6 Chain N

Receptor sequence
>8pw6N (length=380) Species: 10090 (Mus musculus) [Search protein sequence]
MTNMRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQIITGLF
LAMHYTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGR
GLYYGSYTFMETWNIGVLLLFAVMATAFMGYVLPWGQMSFWGATVITNLL
SAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFL
HETGSNNPTGLNSDADKIPFHPYYTIKDILGILIMFLILMTLVLFFPDML
GDPDNYMPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALILSILI
LALMPFLHTSKQRSLMFRPITQILYWILVANLLILTWIGGQPVEHPFIII
GQLASISYFSIILILMPISGIIEDKMLKLY
3D structure
PDB8pw6 SCAF1 drives the compositional diversity of mammalian respirasomes.
ChainN
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 HEM N Q44 I45 G48 L51 A52 R80 H83 G130 L133 P134 H182 F183 P186 F187 Q44 I45 G48 L51 A52 R80 H83 G130 L133 P134 H182 F183 P186 F187
BS02 HEM N W31 G34 H97 V98 R100 S106 W113 G116 L119 H196 L200 N206 W31 G34 H97 V98 R100 S106 W113 G116 L119 H196 L200 N206
Gene Ontology
Molecular Function
GO:0008121 ubiquinol-cytochrome-c reductase activity
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0044877 protein-containing complex binding
GO:0046872 metal ion binding
Biological Process
GO:0001666 response to hypoxia
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
GO:0007584 response to nutrient
GO:0009410 response to xenobiotic stimulus
GO:0009636 response to toxic substance
GO:0009725 response to hormone
GO:0014070 response to organic cyclic compound
GO:0015990 electron transport coupled proton transport
GO:0022904 respiratory electron transport chain
GO:0031100 animal organ regeneration
GO:0033590 response to cobalamin
GO:0033762 response to glucagon
GO:0045333 cellular respiration
GO:0045471 response to ethanol
GO:0046686 response to cadmium ion
GO:0046688 response to copper ion
GO:0046689 response to mercury ion
GO:0051592 response to calcium ion
GO:0055093 response to hyperoxia
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0045275 respiratory chain complex III

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8pw6, PDBe:8pw6, PDBj:8pw6
PDBsum8pw6
PubMed38575788
UniProtP00158|CYB_MOUSE Cytochrome b (Gene Name=Mt-Cyb)

[Back to BioLiP]