Structure of PDB 8pp7 Chain N

Receptor sequence
>8pp7N (length=100) Species: 9606 (Homo sapiens) [Search protein sequence]
TWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTK
ECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYP
3D structure
PDB8pp7 Structural basis of the histone ubiquitination read-write mechanism of RYBP-PRC1.
ChainN
Resolution2.91 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN N C51 C54 C72 C75 C36 C39 C57 C60
BS02 ZN N C67 H69 C87 C90 C52 H54 C72 C75
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0004842 ubiquitin-protein transferase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016740 transferase activity
GO:0046872 metal ion binding
GO:0061630 ubiquitin protein ligase activity
GO:0071535 RING-like zinc finger domain binding
GO:0140862 histone H2AK119 ubiquitin ligase activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0000278 mitotic cell cycle
GO:0001702 gastrulation with mouth forming second
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0007281 germ cell development
GO:0009948 anterior/posterior axis specification
GO:0010467 gene expression
GO:0016567 protein ubiquitination
GO:0040029 epigenetic regulation of gene expression
GO:0043433 negative regulation of DNA-binding transcription factor activity
Cellular Component
GO:0000151 ubiquitin ligase complex
GO:0000791 euchromatin
GO:0000792 heterochromatin
GO:0001739 sex chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0016604 nuclear body
GO:0031519 PcG protein complex
GO:0035102 PRC1 complex
GO:0071339 MLL1 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pp7, PDBe:8pp7, PDBj:8pp7
PDBsum8pp7
PubMed38528151
UniProtQ99496|RING2_HUMAN E3 ubiquitin-protein ligase RING2 (Gene Name=RNF2)

[Back to BioLiP]