Structure of PDB 8p2g Chain N

Receptor sequence
>8p2gN (length=122) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPGG
VVKKGDVVKAVIVRTKSGVRRNDGSYIKFDENACVIIRDDKGPRGTRIFG
PVARELREGNFMKIVSLAPEVL
3D structure
PDB8p2g Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid
ChainN
Resolution2.02 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N M1 Q3 Q4 E5 T6 I22 K23 L25 G26 G27 S28 G29 R30 K31 V40 T42 K44 V57 S67 R70 Y76 K78 M1 Q3 Q4 E5 T6 I22 K23 L25 G26 G27 S28 G29 R30 K31 V40 T42 K44 V57 S67 R70 Y76 K78
BS02 rna N N13 P48 T96 R97 R104 S116 N13 P48 T96 R97 R104 S116
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p2g, PDBe:8p2g, PDBj:8p2g
PDBsum8p2g
PubMed38902339
UniProtQ2FW16|RL14_STAA8 Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]