Structure of PDB 8orq Chain N

Receptor sequence

>8orqN (length=65) Species: 186497 (Pyrococcus furiosus DSM 3638)

MIVPVRCFTCGKVIGDKYYEFKRRVEAGEDPEKVLDDLGLERYCCRRMLL
SHVELIDDIMHYRVY

3D structure

• PDB: 8orq Structural basis of archaeal RNA polymerase transcription elongation and Spt4/5 recruitment
• Chain: N
• Resolution: 3.2 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.6: DNA-directed RNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	N	C7 C10 C45	C7 C10 C45

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003899 DNA-directed 5'-3' RNA polymerase activity
• GO:0008270 zinc ion binding
• GO:0016779 nucleotidyltransferase activity
• GO:0034062 5'-3' RNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006351 DNA-templated transcription

Cellular Component

• GO:0000428 DNA-directed RNA polymerase complex
• GO:0005737 cytoplasm

External links

• PDB: RCSB:8orq, PDBe:8orq, PDBj:8orq
• PDBsum: 8orq
• PubMed: 38709902
• UniProt: P60292|RPO10_PYRFU DNA-directed RNA polymerase subunit Rpo10 (Gene Name=rpo10)