Structure of PDB 8om4 Chain N

Receptor sequence
>8om4N (length=113) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
GNFRFPIKTKLPPGFINARILRDNFKRQQFKENEILVKSLKFIARNMNLP
TKLRLEAQLKLNALPNYMRSTQIKNRCVDSGHARFVLSDFRLCRYQFREN
ALKGNLPGVKKGI
3D structure
PDB8om4 METTL17 is an Fe-S cluster checkpoint for mitochondrial translation.
ChainN
Resolution2.32 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N G2 N3 F4 R5 K9 L12 F16 I17 R20 L22 R23 K27 K42 R46 Q59 N63 N67 R70 T72 Q73 N76 R77 S81 H83 R85 F86 S89 R95 Y96 Q97 R99 G1 N2 F3 R4 K8 L11 F15 I16 R19 L21 R22 K26 K41 R45 Q58 N62 N66 R69 T71 Q72 N75 R76 S80 H82 R84 F85 S88 R94 Y95 Q96 R98
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8om4, PDBe:8om4, PDBj:8om4
PDBsum8om4
PubMed38199006
UniProtP10663|RT02_YEAST Small ribosomal subunit protein uS14m (Gene Name=MRP2)

[Back to BioLiP]