Structure of PDB 8oki Chain N |
>8okiN (length=65) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence] |
MIVPVRCFTCGKVIGDKYYEFKRRVEAGEDPEKVLDDLGLERYCCRRMLL SHVELIDDIMHYRVY |
|
PDB | 8oki Structural basis of archaeal RNA polymerase transcription elongation and Spt4/5 recruitment |
Chain | N |
Resolution | 3.45 Å |
3D structure |
|
|
Enzyme Commision number |
2.7.7.6: DNA-directed RNA polymerase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
N |
C7 C10 |
C7 C10 |
|
|
|
|