Structure of PDB 8ix0 Chain N

Receptor sequence

>8ix0N (length=218) Species: 3562 (Spinacia oleracea) [Search protein sequence]

SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRE
LEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL
GNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDP
LGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL
ADPVNNNAWNFATNFVPG

3D structure

PDB

8ix0 Cryo-EM structures of LHCII in photo-active and photo-protecting states reveal allosteric regulation of light harvesting and excess energy dissipation.

Chain

Resolution

2.64 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CHL	N	Y24 L25	Y11 L12
BS02	CLA	N	L36 G42 Y44 S52 N61 R62 E65 H68 R185 M188 F192	L23 G29 Y31 S39 N48 R49 E52 H55 R172 M175 F179
BS03	CHL	N	V119 H120 S123	V106 H107 S110
BS04	CHL	N	F98 G101	F85 G88
BS05	CHL	N	R142 L148 P157 F161	R129 L135 P144 F148
BS06	CHL	N	L64 I67 H68 W71 M135 E139 I143	L51 I54 H55 W58 M122 E126 I130
BS07	CLA	N	R70 Y156 F161 D162 L166 F173 L176 E180	R57 Y143 F148 D149 L153 F160 L163 E167
BS08	CLA	N	V196 Q197 N208 N220 A221	V183 Q184 N195 N207 A208

Gene Ontology

	Biological Process
GO:0009765	photosynthesis, light harvesting

	Cellular Component
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ix0, PDBe:8ix0, PDBj:8ix0
PDBsum	8ix0
PubMed	37653340
UniProt	P12333\|CB2A_SPIOL Chlorophyll a-b binding protein, chloroplastic

[Back to BioLiP]