Structure of PDB 8iwx Chain N

Receptor sequence

>8iwxN (length=218) Species: 3562 (Spinacia oleracea)

SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRE
LEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL
GNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDP
LGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL
ADPVNNNAWNFATNFVPG

3D structure

• PDB: 8iwx Cryo-EM structures of LHCII in photo-active and photo-protecting states reveal allosteric regulation of light harvesting and excess energy dissipation.
• Chain: N
• Resolution: 2.59 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	N	Y24 Y44 W46	Y11 Y31 W33
BS02	CLA	N	G42 D43 Y44 G45 W46 D47 L51 S52 N61 R62 E65 H68 R185 M188 F189 F192	G29 D30 Y31 G32 W33 D34 L38 S39 N48 R49 E52 H55 R172 M175 F176 F179
BS03	CLA	N	L64 H68	L51 H55
BS04	CLA	N	G78 F81 F92 L110 Y112 L113 L118 V119	G65 F68 F79 L97 Y99 L100 L105 V106
BS05	CHL	N	L118 V119 H120 Q122 S123	L105 V106 H107 Q109 S110
BS06	CHL	N	I127 Q131 L134	I114 Q118 L121
BS07	CHL	N	F98 K99 G101 S102 Q131 F195 I199	F85 K86 G88 S89 Q118 F182 I186
BS08	CHL	N	R70 V138 Y141 R142 G146 P147 L148 G149 P157 S160 F161	R57 V125 Y128 R129 G133 P134 L135 G136 P144 S147 F148
BS09	CHL	N	L64 I67 H68 W71 G136 E139 R142	L51 I54 H55 W58 G123 E126 R129
BS10	CLA	N	R70 M73 Y156 F161 D162 L166 F173 L176 E180	R57 M60 Y143 F148 D149 L153 F160 L163 E167
BS11	CLA	N	W16 K179 K182 N183 L186	W3 K166 K169 N170 L173
BS12	CLA	N	K179 N183	K166 N170
BS13	CLA	N	F189 G193 V196 Q197 N208 H212 N220 A221	F176 G180 V183 Q184 N195 H199 N207 A208
BS14	CLA	N	L209 H212 P216 N220	L196 H199 P203 N207
BS15	CHL	N	A225 V229 P230	A212 V216 P217
BS16	CHL	N	W46 T48	W33 T35
BS17	CLA	N	L125 W128	L112 W115

Gene Ontology

Biological Process

• GO:0009765 photosynthesis, light harvesting

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:8iwx, PDBe:8iwx, PDBj:8iwx
• PDBsum: 8iwx
• PubMed: 37653340
• UniProt: P12333|CB2A_SPIOL Chlorophyll a-b binding protein, chloroplastic