Structure of PDB 8i0z Chain N |
>8i0zN (length=107) Species: 10090 (Mus musculus) [Search protein sequence] |
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYS ASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQ GTKVEIK |
|
PDB | 8i0z Structure of beta-arrestin in complex with a phosphopeptide |
Chain | N |
Resolution | 4.33 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
N |
S31 R67 |
S30 R66 |
|
|
|