Structure of PDB 8i0s Chain N

Receptor sequence
>8i0sN (length=143) Species: 9606 (Homo sapiens) [Search protein sequence]
MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIF
RIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENL
CCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCS
3D structure
PDB8i0s Molecular Basis for the Activation of Human Spliceosome
ChainN
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N G39 Q95 G96 Y97 E98 T111 N112 T115 N116 C117 I118 H136 G39 Q95 G96 Y97 E98 T111 N112 T115 N116 C117 I118 H136
BS02 ZN N C117 C134 H136 C117 C134 H136
BS03 ZN N C101 C119 C139 C142 C101 C119 C139 C142
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016922 nuclear receptor binding
GO:0030374 nuclear receptor coactivator activity
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045893 positive regulation of DNA-templated transcription
GO:2000825 positive regulation of androgen receptor activity
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0071007 U2-type catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i0s, PDBe:8i0s, PDBj:8i0s
PDBsum8i0s
PubMed39068178
UniProtP41223|BUD31_HUMAN Protein BUD31 homolog (Gene Name=BUD31)

[Back to BioLiP]