Structure of PDB 8eug Chain N

Receptor sequence

>8eugN (length=200) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]

GAYKYLEELAKKKQSDVNLFLSRVRAWEYRQMNVIHRASRPSRPDKARRL
GYKAKQGYVIYRIRVRRGGRKRPVPKGQTYGKPVHQGVNHLKYQRSARCT
AEERVGRYCSNLRVLNSYWVNQDATYKFFEVILVDPSHKAIRRDPRINWI
VNPVHKHRESRGLTSIGKKSRGIGKGHRFNNSPQHATWLRHNTLSLRRYR

3D structure

PDB

8eug Chromatin localization of nucleophosmin organizes ribosome biogenesis.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	G2 Y4 K5 E8 K12 K14 Q15 R24 W28 R31 N34 V35 S40 R41 R44 K47 R49 R50 L51 K54 A55 Q57 R67 R68 G69 G70 R71 K72 R73 P74 P76 K77 Q79 Y81 G82 K83 V85 H86 Q87 V89 N90 H91 K93 Y94 Q95 S97 R105 R108 S111 N112 W120 A125 Y127 S138 K140 R144 R147 W150 P154 V155 H156 K157 H158 S161 R162 L164 S166 K169 K170 S171 R172 I174 K176 G177 H178 R179 N181 Q185 W189 R191 H192 S196 R198 R199 Y200 R201	G1 Y3 K4 E7 K11 K13 Q14 R23 W27 R30 N33 V34 S39 R40 R43 K46 R48 R49 L50 K53 A54 Q56 R66 R67 G68 G69 R70 K71 R72 P73 P75 K76 Q78 Y80 G81 K82 V84 H85 Q86 V88 N89 H90 K92 Y93 Q94 S96 R104 R107 S110 N111 W119 A124 Y126 S137 K139 R143 R146 W149 P153 V154 H155 K156 H157 S160 R161 L163 S165 K168 K169 S170 R171 I173 K175 G176 H177 R178 N180 Q184 W188 R190 H191 S195 R197 R198 Y199 R200
BS02	rna	N	R38 Q57 Y62 Y109 C110 N112 L113 D136 H139	R37 Q56 Y61 Y108 C109 N111 L112 D135 H138

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8eug, PDBe:8eug, PDBj:8eug
PDBsum	8eug
PubMed	36423630
UniProt	O74895\|RL15A_SCHPO Large ribosomal subunit protein eL15A (Gene Name=rpl15)

[Back to BioLiP]