Structure of PDB 8cdu Chain N

Receptor sequence
>8cduN (length=49) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
TPKFKVQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW
3D structure
PDB8cdu Structural basis of ribosomal 30S subunit degradation by RNase R
ChainN
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna N K15 F16 V18 Q19 Y21 T22 R29 H31 S32 I34 R35 R41 I42 R45 S60 W61 K3 F4 V6 Q7 Y9 T10 R17 H19 S20 I22 R23 R29 I30 R33 S48 W49
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cdu, PDBe:8cdu, PDBj:8cdu
PDBsum8cdu
PubMed38326618
UniProtP12878|RS14B_BACSU Small ribosomal subunit protein uS14B (Gene Name=rpsN1)

[Back to BioLiP]