Structure of PDB 8buu Chain N

Receptor sequence

>8buuN (length=119) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

SYRKLGRTSAQRKAMLRDLTTDLIINERIETTETRAKELRSVVEKMITLG
KRGDLHARRQAAAYIRNEVANEENNQDALQKLFSDIATRYEERQGGYTRI
MKLGPRRGDGAPMAIIELV

3D structure

• PDB: 8buu Genome-encoded ABCF factors implicated in intrinsic antibiotic resistance in Gram-positive bacteria: VmlR2, Ard1 and CplR.
• Chain: N
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	N	S2 Y3 R4 K5 G7 R8 S10 Q12 R13 K14 A15 L17 R18 L20 D23 N27 I30 E31 T32 T35 R36 K38 E39 S42 E45 K46 T49 R53 L56 H57 R59 R60 Q61 A64 R67 E69 R94 Q95 G96 G97 T99 R100 K103 R107 R108 G109 D110	S1 Y2 R3 K4 G6 R7 S9 Q11 R12 K13 A14 L16 R17 L19 D22 N26 I29 E30 T31 T34 R35 K37 E38 S41 E44 K45 T48 R52 L55 H56 R58 R59 Q60 A63 R66 E68 R93 Q94 G95 G96 T98 R99 K102 R106 R107 G108 D109

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8buu, PDBe:8buu, PDBj:8buu
• PDBsum: 8buu
• PubMed: 36951104
• UniProt: P20277|RL17_BACSU Large ribosomal subunit protein bL17 (Gene Name=rplQ)