Structure of PDB 7zcu Chain N

Receptor sequence
>7zcuN (length=46) Species: 74570 (Rhodopseudomonas palustris ATCC 17001) [Search protein sequence]
ADKTLTGLTVEESEELHKHVIDGTRIFGAIAIVAHFLAYVYSPWLH
3D structure
PDB7zcu Cryo-EM structures of light-harvesting 2 complexes from Rhodopseudomonas palustris reveal the molecular origin of absorption tuning.
ChainN
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL N R26 A30 V34 R25 A29 V33
BS02 BCL N I22 T25 R26 I21 T24 R25
BS03 BCL N F28 I31 A32 A35 H36 F27 I30 A31 A34 H35
BS04 BCL N T25 F28 G29 H36 W45 T24 F27 G28 H35 W44
BS05 IRM N E16 L17 H20 G24 T25 E15 L16 H19 G23 T24
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zcu, PDBe:7zcu, PDBj:7zcu
PDBsum7zcu
PubMed36251992
UniProtP35106|LHB1_RHOPA Light-harvesting protein B-800-850 beta chain A (Gene Name=pucBA)

[Back to BioLiP]