Structure of PDB 7vy3 Chain N

Receptor sequence

>7vy3N (length=43) Species: 39723 (Cereibacter sphaeroides f. sp. denitrificans)

LGYTGLTDEQAQELHSVYMSGLWLFSAVAIVAHLAVYIWRPWF

3D structure

• PDB: 7vy3 Asymmetric structure of the native Rhodobacter sphaeroides dimeric LH1-RC complex.
• Chain: N
• Resolution: 2.63 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SPO	N	V33 A37 A40 V41 W44	V28 A32 A35 V36 W39
BS02	BCL	N	F30 V33 A34 H38	F25 V28 A29 H33
BS03	SPO	N	E18 L19 V22 Y23 G26 L27	E13 L14 V17 Y18 G21 L22
BS04	BCL	N	F30 A34 H38 Y42 W47 F48	F25 A29 H33 Y37 W42 F43

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Dec 2 07:42:18 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7vy3', asym_id = 'N', title = 'Asymmetric structure of the native Rhodobacter sphaeroides dimeric LH1-RC complex.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7vy3', asym_id='N', title='Asymmetric structure of the native Rhodobacter sphaeroides dimeric LH1-RC complex.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016020,0019684,0030077,0045156', uniprot = '', pdbid = '7vy3', asym_id = 'N'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016020,0019684,0030077,0045156', uniprot='', pdbid='7vy3', asym_id='N')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>